SCOPe 2.07: Domain d2ou0x_: 2ou0 X:

Lineage for d2ou0x_ (2ou0 X:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d2ou0x_: 2ou0 X: [149017]
   automated match to d181la_
   complexed with mr3, po4

Details for d2ou0x_

PDB Entry: 2ou0, 1.94 Å

PDB Description: 1-methylpyrrole in complex with t4 lysozyme l99a

PDB Compounds: (X:) lysozyme

SCOPe Domain Sequences for d2ou0x_:

Sequence; same for both SEQRES and ATOM records:

>d2ou0x_ d.2.1.3 (X:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d2ou0x_:

• d2ou0x_ first appeared in SCOP 1.75, called d2ou0x1
  
• d2ou0x_ appears in SCOPe 2.06
  
• d2ou0x_ appears in the current release, SCOPe 2.08