SCOP 1.75: Domain d2ou0x1: 2ou0 X:1-162

Lineage for d2ou0x1 (2ou0 X:1-162)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (11 families)

5. Family d.2.1.3: Phage lysozyme [53981] (3 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (446 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d2ou0x1: 2ou0 X:1-162 [149017]
   automatically matched to d181la_
   complexed with mr3, po4

Details for d2ou0x1

PDB Entry: 2ou0, 1.94 Å

PDB Description: 1-methylpyrrole in complex with t4 lysozyme l99a

PDB Compounds: (X:) lysozyme

SCOP Domain Sequences for d2ou0x1:

Sequence; same for both SEQRES and ATOM records:

>d2ou0x1 d.2.1.3 (X:1-162) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d2ou0x1:

• d2ou0x1 is new in SCOP 1.75
  
• d2ou0x1 is called d2ou0x_ in SCOPe 2.01
  
• d2ou0x1 appears in the current release, SCOPe 2.08, called d2ou0x_