SCOPe 2.08: Domain d2otzx_: 2otz X:

Lineage for d2otzx_ (2otz X:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d2otzx_: 2otz X: [149016]
   automated match to d181la_
   complexed with 1mr, po4

Details for d2otzx_

PDB Entry: 2otz, 2.07 Å

PDB Description: n-methylaniline in complex with t4 lysozyme l99a

PDB Compounds: (X:) lysozyme

SCOPe Domain Sequences for d2otzx_:

Sequence; same for both SEQRES and ATOM records:

>d2otzx_ d.2.1.3 (X:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d2otzx_:

• d2otzx_ first appeared in SCOP 1.75, called d2otzx1
  
• d2otzx_ appears in SCOPe 2.07