| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (4 families) ![]() forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
| Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins) some members possess an endoribonuclease activity inhibiting mRNA translation |
| Protein Hypothetical protein SO1960 [160498] (1 species) |
| Species Shewanella oneidensis [TaxId:70863] [160499] (1 PDB entry) Uniprot Q8EFL1 2-153 |
| Domain d2otmb_: 2otm B: [149013] automated match to d2otma1 complexed with act, ca, gol, na |
PDB Entry: 2otm (more details), 1.85 Å
SCOPe Domain Sequences for d2otmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otmb_ d.79.1.1 (B:) Hypothetical protein SO1960 {Shewanella oneidensis [TaxId: 70863]}
mmntpesrlvaaglelpevaaalgnyepysivgsqlmtsgqfpylqgkllyqgqlgadyt
vsegyaacrlatlnaiaqlkqacgelsrikqiyrlegvlnvhqsciehpkaldgasdlll
eifgeagrhsrmiwtnpvmplnslclvylfael
Timeline for d2otmb_: