SCOPe 2.08: Domain d2otmb_: 2otm B:

Lineage for d2otmb_ (2otm B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (4 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
   some members possess an endoribonuclease activity inhibiting mRNA translation

6. Protein Hypothetical protein SO1960 [160498] (1 species)

7. Species Shewanella oneidensis [TaxId:70863] [160499] (1 PDB entry)
   Uniprot Q8EFL1 2-153

8. Domain d2otmb_: 2otm B: [149013]
   automated match to d2otma1
   complexed with act, ca, gol, na

Details for d2otmb_

PDB Entry: 2otm, 1.85 Å

PDB Description: crystal structure of a putative endoribonuclease (so_1960) from shewanella oneidensis mr-1 at 1.85 a resolution

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2otmb_:

Sequence; same for both SEQRES and ATOM records:

>d2otmb_ d.79.1.1 (B:) Hypothetical protein SO1960 {Shewanella oneidensis [TaxId: 70863]}
mmntpesrlvaaglelpevaaalgnyepysivgsqlmtsgqfpylqgkllyqgqlgadyt
vsegyaacrlatlnaiaqlkqacgelsrikqiyrlegvlnvhqsciehpkaldgasdlll
eifgeagrhsrmiwtnpvmplnslclvylfael

Timeline for d2otmb_:

• d2otmb_ first appeared in SCOP 1.75, called d2otmb1
  
• d2otmb_ appears in SCOPe 2.07