Lineage for d2otma1 (2otm A:2-153)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958620Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 2958659Protein Hypothetical protein SO1960 [160498] (1 species)
  7. 2958660Species Shewanella oneidensis [TaxId:70863] [160499] (1 PDB entry)
    Uniprot Q8EFL1 2-153
  8. 2958661Domain d2otma1: 2otm A:2-153 [149012]
    complexed with act, ca, gol, na

Details for d2otma1

PDB Entry: 2otm (more details), 1.85 Å

PDB Description: crystal structure of a putative endoribonuclease (so_1960) from shewanella oneidensis mr-1 at 1.85 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2otma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otma1 d.79.1.1 (A:2-153) Hypothetical protein SO1960 {Shewanella oneidensis [TaxId: 70863]}
mntpesrlvaaglelpevaaalgnyepysivgsqlmtsgqfpylqgkllyqgqlgadytv
segyaacrlatlnaiaqlkqacgelsrikqiyrlegvlnvhqsciehpkaldgasdllle
ifgeagrhsrmiwtnpvmplnslclvylfael

SCOPe Domain Coordinates for d2otma1:

Click to download the PDB-style file with coordinates for d2otma1.
(The format of our PDB-style files is described here.)

Timeline for d2otma1: