Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) |
Family c.52.1.33: YaeQ-like [159605] (2 proteins) Pfam PF07152; contains extra N- and C-terminal beta-structures forming additional five-stranded beta-sheet; retains the PD motif in the putative active site |
Protein Hypothetical protein PSPTO1487 [159608] (1 species) |
Species Pseudomonas syringae pv. tomato [TaxId:323] [159609] (1 PDB entry) Uniprot Q886T9 2-180 |
Domain d2ot9a1: 2ot9 A:2-180 [149009] complexed with na, srt |
PDB Entry: 2ot9 (more details), 1.97 Å
SCOPe Domain Sequences for d2ot9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ot9a1 c.52.1.33 (A:2-180) Hypothetical protein PSPTO1487 {Pseudomonas syringae pv. tomato [TaxId: 323]} aqpsttykfelnltdldrgvyesvkqtiarhpseteermtvrllayafwyneqlafgrgl sdvdepalwekslddrvlhwievgqpdadrltwcsrrtertsllaygslrvwegkvipai knlknvniaavpqdvlevlakdmprvikwdvmisegtvfvtddrgqhevqlqwltgerg
Timeline for d2ot9a1: