Lineage for d2ot9a1 (2ot9 A:2-180)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882695Family c.52.1.33: YaeQ-like [159605] (2 proteins)
    Pfam PF07152; contains extra N- and C-terminal beta-structures forming additional five-stranded beta-sheet; retains the PD motif in the putative active site
  6. 2882696Protein Hypothetical protein PSPTO1487 [159608] (1 species)
  7. 2882697Species Pseudomonas syringae pv. tomato [TaxId:323] [159609] (1 PDB entry)
    Uniprot Q886T9 2-180
  8. 2882698Domain d2ot9a1: 2ot9 A:2-180 [149009]
    complexed with na, srt

Details for d2ot9a1

PDB Entry: 2ot9 (more details), 1.97 Å

PDB Description: Crystal structure of YaeQ protein from Pseudomonas syringae
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2ot9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ot9a1 c.52.1.33 (A:2-180) Hypothetical protein PSPTO1487 {Pseudomonas syringae pv. tomato [TaxId: 323]}
aqpsttykfelnltdldrgvyesvkqtiarhpseteermtvrllayafwyneqlafgrgl
sdvdepalwekslddrvlhwievgqpdadrltwcsrrtertsllaygslrvwegkvipai
knlknvniaavpqdvlevlakdmprvikwdvmisegtvfvtddrgqhevqlqwltgerg

SCOPe Domain Coordinates for d2ot9a1:

Click to download the PDB-style file with coordinates for d2ot9a1.
(The format of our PDB-style files is described here.)

Timeline for d2ot9a1: