SCOPe 2.08: Domain d2ot5a_: 2ot5 A:

Lineage for d2ot5a_ (2ot5 A:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (2 families)

5. Family h.3.2.1: Virus ectodomain [58070] (9 proteins)

6. Protein Retrovius gp41 protease-resistant core [58071] (4 species)
   coiled coil; biological unit: trimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (26 PDB entries)

8. Domain d2ot5a_: 2ot5 A: [149008]
   automated match to d3cp1a1
   mutant

Details for d2ot5a_

PDB Entry: 2ot5, 1.8 Å

PDB Description: Crystal structure of the HIV gp41 core with the enfuvirtide resistance mutation N43D

PDB Compounds: (A:) hiv-1 gp41 glycoprotein

SCOPe Domain Sequences for d2ot5a_:

Sequence; same for both SEQRES and ATOM records:

>d2ot5a_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
sgivqqqndllraieaqqhllqltvwgikqlqarsggrggwmewdreinnytslihslie
esqnqqe

Timeline for d2ot5a_:

• d2ot5a_ first appeared in SCOP 1.75, called d2ot5a1
  
• d2ot5a_ appears in SCOPe 2.07