SCOP 1.75: Domain d2osoa1: 2oso A:5-156

Lineage for d2osoa1 (2oso A:5-156)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
   an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity

4. Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (3 families)

5. Family d.278.1.3: MJ1460-like [160689] (1 protein)
   C-terminal part corresponds to Pfam PF02830; V4R (vinyl 4 reductase) domain

6. Protein Hypothetical protein MJ1460 [160690] (1 species)

7. Species Methanococcus jannaschii [TaxId:2190] [160691] (2 PDB entries)
   Uniprot Q58855 5-156

8. Domain d2osoa1: 2oso A:5-156 [149006]
   automatically matched to 2OSD A:5-156
   complexed with act, cl, gol, zn; mutant

Details for d2osoa1

PDB Entry: 2oso, 1.9 Å

PDB Description: crystal structure of a vinyl-4-reductase family protein (mj_1460) from methanocaldococcus jannaschii dsm at 1.90 a resolution

PDB Compounds: (A:) Hypothetical protein MJ1460

SCOP Domain Sequences for d2osoa1:

Sequence, based on SEQRES records:

>d2osoa1 d.278.1.3 (A:5-156) Hypothetical protein MJ1460 {Methanococcus jannaschii [TaxId: 2190]}
ekifpdileairneeiikeskkipmpyfglfalvifdkvkelgsetslyeigeefgkmls
pknieelkkifklmnfgdleidenkillknppykiklsnppyqwvskeepihdfiagila
gcleeifyyyfvvnevecvsqgkdkcvfevke

Sequence, based on observed residues (ATOM records):

>d2osoa1 d.278.1.3 (A:5-156) Hypothetical protein MJ1460 {Methanococcus jannaschii [TaxId: 2190]}
ekifpdileairneeiikeskkipmpyfglfalvifdkvkgsetslyeigeefgkmlspk
nieelkkifklmnfgdleidenkillknppykiklsnppyqwvskeepihdfiagilagc
leeifyyyfvvnevecvsqgkdkcvfevke

Timeline for d2osoa1:

• d2osoa1 is new in SCOP 1.75
  
• d2osoa1 is called d2osoa_ in SCOPe 2.01
  
• d2osoa1 appears in the current release, SCOPe 2.08, called d2osoa2