SCOP 1.75: Domain d2or9i1: 2or9 I:114-212

Lineage for d2or9i1 (2or9 I:114-212)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (373 PDB entries)
   Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele)
   Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity
   SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)
   Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form
   Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region
   Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region
   Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele
   SQ NA # part of Fab 28 against HIV-1 RT
   Uniprot P01868 #
   GC1_MOUSE Ig gamma-1 chain C region secreted form
   Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form

8. Domain d2or9i1: 2or9 I:114-212 [149000]
   automatically matched to d1fnsh2

Details for d2or9i1

PDB Entry: 2or9, 2.7 Å

PDB Description: The structure of the anti-c-myc antibody 9E10 Fab fragment/epitope peptide complex reveals a novel binding mode dominated by the heavy chain hypervariable loops

PDB Compounds: (I:) Monoclonal anti-c-myc antibody 9E10

SCOP Domain Sequences for d2or9i1:

Sequence; same for both SEQRES and ATOM records:

>d2or9i1 b.1.1.2 (I:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

Timeline for d2or9i1:

• d2or9i1 is new in SCOP 1.75
  
• d2or9i1 appears in SCOPe 2.01
  
• d2or9i1 appears in the current release, SCOPe 2.08