Class a: All alpha proteins [46456] (284 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (3 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (13 proteins) |
Protein Interleukin-21 (IL-21) [158425] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158426] (1 PDB entry) Uniprot Q9HBE4 23-155 |
Domain d2oqpa1: 2oqp A:2-134 [148997] |
PDB Entry: 2oqp (more details)
SCOP Domain Sequences for d2oqpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oqpa1 a.26.1.2 (A:2-134) Interleukin-21 (IL-21) {Human (Homo sapiens) [TaxId: 9606]} qgqdrhmirmrqlidivdqlknyvndlvpeflpapedvetncewsafscfqkaqlksant gnneriinvsikklkrkppstnagrrqkhrltcpscdsyekkppkeflerfksllqkmih qhlssrthgseds
Timeline for d2oqpa1: