SCOP 1.75: Domain d2oqoa1: 2oqo A:57-243

Lineage for d2oqoa1 (2oqo A:57-243)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (11 families)

5. Family d.2.1.10: PBP transglycosylase domain-like [159832] (2 proteins)
   Pfam PF00912; lacking the characteristic beta-sheet; otherwise has a similar fold to the Family 19 glycosidase

6. Protein Penicillin-binding protein 1a, PBP1a [159833] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [159834] (2 PDB entries)
   Uniprot O66874 57-243

8. Domain d2oqoa1: 2oqo A:57-243 [148996]
   Transglycosylase domain only
   complexed with cps, epe

Details for d2oqoa1

PDB Entry: 2oqo, 2.1 Å

PDB Description: crystal structure of a peptidoglycan glycosyltransferase from a class a pbp: insight into bacterial cell wall synthesis

PDB Compounds: (A:) Penicillin-binding protein 1A (PBP-1a) (PBP1a)

SCOP Domain Sequences for d2oqoa1:

Sequence, based on SEQRES records:

>d2oqoa1 d.2.1.10 (A:57-243) Penicillin-binding protein 1a, PBP1a {Aquifex aeolicus [TaxId: 63363]}
tigiqkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraaivnyragrivqggs
titqqlaknlfltrertlerkikeallaikiertfdkkkimelylnqiylgsgaygveaa
aqvyfgkhvwelsldeaallaalpkapakynpfyhperalqrrnlvlkrmleegyitpeq
yeeavnk

Sequence, based on observed residues (ATOM records):

>d2oqoa1 d.2.1.10 (A:57-243) Penicillin-binding protein 1a, PBP1a {Aquifex aeolicus [TaxId: 63363]}
tigiqkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraaivnvqggstitqql
aknlfltrertlerkikeallaikiertfdkkkimelylnqiylgsgaygveaaaqvyfg
khvwelsldeaallaalpkapakynpfyhperalqrrnlvlkrmleegyitpeqyeeavn
k

Timeline for d2oqoa1:

• d2oqoa1 is new in SCOP 1.75
  
• d2oqoa1 appears in SCOPe 2.01
  
• d2oqoa1 appears in the current release, SCOPe 2.08