Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.10: PBP transglycosylase domain-like [159832] (3 proteins) Pfam PF00912; lacking the characteristic beta-sheet; otherwise has a similar fold to the Family 19 glycosidase |
Protein Penicillin-binding protein 1a, PBP1a [159833] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [159834] (2 PDB entries) Uniprot O66874 57-243 |
Domain d2oqoa1: 2oqo A:57-243 [148996] Transglycosylase domain only complexed with cps, epe |
PDB Entry: 2oqo (more details), 2.1 Å
SCOPe Domain Sequences for d2oqoa1:
Sequence, based on SEQRES records: (download)
>d2oqoa1 d.2.1.10 (A:57-243) Penicillin-binding protein 1a, PBP1a {Aquifex aeolicus [TaxId: 63363]} tigiqkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraaivnyragrivqggs titqqlaknlfltrertlerkikeallaikiertfdkkkimelylnqiylgsgaygveaa aqvyfgkhvwelsldeaallaalpkapakynpfyhperalqrrnlvlkrmleegyitpeq yeeavnk
>d2oqoa1 d.2.1.10 (A:57-243) Penicillin-binding protein 1a, PBP1a {Aquifex aeolicus [TaxId: 63363]} tigiqkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraaivnvqggstitqql aknlfltrertlerkikeallaikiertfdkkkimelylnqiylgsgaygveaaaqvyfg khvwelsldeaallaalpkapakynpfyhperalqrrnlvlkrmleegyitpeqyeeavn k
Timeline for d2oqoa1: