![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.213: DinB/YfiT-like putative metalloenzymes [109853] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order |
![]() | Superfamily a.213.1: DinB/YfiT-like putative metalloenzymes [109854] (4 families) ![]() contains metal-binding site on the bundle surface surrounded by loops |
![]() | Family a.213.1.3: Sden0562-like [158519] (1 protein) Pfam PF09351; DUF1993 |
![]() | Protein Hypothetical protein Sden0562 [158520] (1 species) |
![]() | Species Shewanella denitrificans [TaxId:192073] [158521] (1 PDB entry) Uniprot Q12RS4 1-171 |
![]() | Domain d2oqmd2: 2oqm D:1-171 [148995] Other proteins in same PDB: d2oqma2, d2oqmb3, d2oqmc3, d2oqmd3 automated match to d2oqma1 complexed with cl, edo, fmt |
PDB Entry: 2oqm (more details), 1.83 Å
SCOPe Domain Sequences for d2oqmd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oqmd2 a.213.1.3 (D:1-171) Hypothetical protein Sden0562 {Shewanella denitrificans [TaxId: 192073]} mlydltvvqfskmlknlnaifdkaeafaelkkvdmdvllnsrlaadqfnlirqvqiacdt akvgvarltgqletapkhddsettlaelrqriasvltylegfseadfanaatiqisqprw qgkyltgyefaiehaipnlyfhittaygilrhngvevgkkdylgampykap
Timeline for d2oqmd2: