SCOPe 2.08: Domain d2oqmc2: 2oqm C:1-173

Lineage for d2oqmc2 (2oqm C:1-173)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.213: DinB/YfiT-like putative metalloenzymes [109853] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order

4. Superfamily a.213.1: DinB/YfiT-like putative metalloenzymes [109854] (4 families)
   contains metal-binding site on the bundle surface surrounded by loops

5. Family a.213.1.3: Sden0562-like [158519] (1 protein)
   Pfam PF09351; DUF1993

6. Protein Hypothetical protein Sden0562 [158520] (1 species)

7. Species Shewanella denitrificans [TaxId:192073] [158521] (1 PDB entry)
   Uniprot Q12RS4 1-171

8. Domain d2oqmc2: 2oqm C:1-173 [148994]
   Other proteins in same PDB: d2oqma2, d2oqmb3, d2oqmc3, d2oqmd3
   automated match to d2oqma1
   complexed with cl, edo, fmt

Details for d2oqmc2

PDB Entry: 2oqm, 1.83 Å

PDB Description: crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution

PDB Compounds: (C:) hypothetical protein

SCOPe Domain Sequences for d2oqmc2:

Sequence; same for both SEQRES and ATOM records:

>d2oqmc2 a.213.1.3 (C:1-173) Hypothetical protein Sden0562 {Shewanella denitrificans [TaxId: 192073]}
mlydltvvqfskmlknlnaifdkaeafaelkkvdmdvllnsrlaadqfnlirqvqiacdt
akvgvarltgqletapkhddsettlaelrqriasvltylegfseadfanaatiqisqprw
qgkyltgyefaiehaipnlyfhittaygilrhngvevgkkdylgampykapil

Timeline for d2oqmc2:

• d2oqmc2 first appeared in SCOP 1.75, called d2oqmc1
  
• d2oqmc2 appears in SCOPe 2.07