Lineage for d2oqma1 (2oqm A:1-171)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780470Fold a.213: DinB/YfiT-like putative metalloenzymes [109853] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order
  4. 780471Superfamily a.213.1: DinB/YfiT-like putative metalloenzymes [109854] (4 families) (S)
    contains metal-binding site on the bundle surface surrounded by loops
  5. 780494Family a.213.1.3: Sden0562-like [158519] (1 protein)
    Pfam PF09351; DUF1993
  6. 780495Protein Hypothetical protein Sden0562 [158520] (1 species)
  7. 780496Species Shewanella denitrificans [TaxId:192073] [158521] (1 PDB entry)
    Uniprot Q12RS4 1-171
  8. 780497Domain d2oqma1: 2oqm A:1-171 [148992]
    complexed with cl, edo, fmt

Details for d2oqma1

PDB Entry: 2oqm (more details), 1.83 Å

PDB Description: crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution
PDB Compounds: (A:) hypothetical protein

SCOP Domain Sequences for d2oqma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oqma1 a.213.1.3 (A:1-171) Hypothetical protein Sden0562 {Shewanella denitrificans [TaxId: 192073]}
mlydltvvqfskmlknlnaifdkaeafaelkkvdmdvllnsrlaadqfnlirqvqiacdt
akvgvarltgqletapkhddsettlaelrqriasvltylegfseadfanaatiqisqprw
qgkyltgyefaiehaipnlyfhittaygilrhngvevgkkdylgampykap

SCOP Domain Coordinates for d2oqma1:

Click to download the PDB-style file with coordinates for d2oqma1.
(The format of our PDB-style files is described here.)

Timeline for d2oqma1: