Lineage for d2oqje1 (2oqj E:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739899Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (30 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
  8. 2739931Domain d2oqje1: 2oqj E:1-112 [148986]
    Other proteins in same PDB: d2oqjb2, d2oqje2, d2oqjh2, d2oqjk2
    automatically matched to d1aqkh1

Details for d2oqje1

PDB Entry: 2oqj (more details), 2.8 Å

PDB Description: Crystal structure analysis of Fab 2G12 in complex with peptide 2G12.1
PDB Compounds: (E:) Fab 2G12 heavy chain

SCOPe Domain Sequences for d2oqje1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oqje1 b.1.1.1 (E:1-112) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
vs

SCOPe Domain Coordinates for d2oqje1:

Click to download the PDB-style file with coordinates for d2oqje1.
(The format of our PDB-style files is described here.)

Timeline for d2oqje1: