![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
![]() | Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) ![]() |
![]() | Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins) |
![]() | Protein Endonuclease VIII [82233] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [82234] (8 PDB entries) Uniprot P50465 |
![]() | Domain d2oq4b2: 2oq4 B:1-124 [148982] Other proteins in same PDB: d2oq4a1, d2oq4a3, d2oq4b1, d2oq4b3 automatically matched to d1k3wa2 complexed with na, ped, so4, zn; mutant |
PDB Entry: 2oq4 (more details), 2.6 Å
SCOP Domain Sequences for d2oq4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oq4b2 b.113.1.1 (B:1-124) Endonuclease VIII {Escherichia coli [TaxId: 562]} pqgpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsn dltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthp flqr
Timeline for d2oq4b2: