Lineage for d2oq4b2 (2oq4 B:1-124)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 812259Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 812260Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
  5. 812261Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins)
  6. 812290Protein Endonuclease VIII [82233] (1 species)
  7. 812291Species Escherichia coli [TaxId:562] [82234] (8 PDB entries)
    Uniprot P50465
  8. 812300Domain d2oq4b2: 2oq4 B:1-124 [148982]
    Other proteins in same PDB: d2oq4a1, d2oq4a3, d2oq4b1, d2oq4b3
    automatically matched to d1k3wa2
    complexed with na, ped, so4, zn; mutant

Details for d2oq4b2

PDB Entry: 2oq4 (more details), 2.6 Å

PDB Description: crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (e2q) in complex with ap-site containing dna substrate
PDB Compounds: (B:) Endonuclease VIII

SCOP Domain Sequences for d2oq4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oq4b2 b.113.1.1 (B:1-124) Endonuclease VIII {Escherichia coli [TaxId: 562]}
pqgpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsn
dltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthp
flqr

SCOP Domain Coordinates for d2oq4b2:

Click to download the PDB-style file with coordinates for d2oq4b2.
(The format of our PDB-style files is described here.)

Timeline for d2oq4b2: