Lineage for d2oq4a3 (2oq4 A:224-262)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035992Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 3036035Protein Endonuclease VIII [82917] (1 species)
  7. 3036036Species Escherichia coli [TaxId:562] [82918] (8 PDB entries)
    Uniprot P50465
  8. 3036044Domain d2oq4a3: 2oq4 A:224-262 [148980]
    Other proteins in same PDB: d2oq4a1, d2oq4a2, d2oq4b1, d2oq4b2
    automated match to d1k3xa3
    protein/DNA complex; complexed with na, so4, zn

Details for d2oq4a3

PDB Entry: 2oq4 (more details), 2.6 Å

PDB Description: crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (e2q) in complex with ap-site containing dna substrate
PDB Compounds: (A:) Endonuclease VIII

SCOPe Domain Sequences for d2oq4a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oq4a3 g.39.1.8 (A:224-262) Endonuclease VIII {Escherichia coli [TaxId: 562]}
lfrfkvfhrdgepcercgsiiekttlssrpfywcpgcqh

SCOPe Domain Coordinates for d2oq4a3:

Click to download the PDB-style file with coordinates for d2oq4a3.
(The format of our PDB-style files is described here.)

Timeline for d2oq4a3: