Lineage for d2oq4a1 (2oq4 A:125-213)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779264Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 779265Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 779340Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
    contains 4 helices in the core
  6. 779369Protein Endonuclease VIII [81703] (1 species)
  7. 779370Species Escherichia coli [TaxId:562] [81704] (8 PDB entries)
    Uniprot P50465
  8. 779378Domain d2oq4a1: 2oq4 A:125-213 [148978]
    Other proteins in same PDB: d2oq4a2, d2oq4a3, d2oq4b2, d2oq4b3
    automatically matched to d1k3wa1
    complexed with na, ped, so4, zn; mutant

Details for d2oq4a1

PDB Entry: 2oq4 (more details), 2.6 Å

PDB Description: crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (e2q) in complex with ap-site containing dna substrate
PDB Compounds: (A:) Endonuclease VIII

SCOP Domain Sequences for d2oq4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oq4a1 a.156.1.2 (A:125-213) Endonuclease VIII {Escherichia coli [TaxId: 562]}
vgpdvldpnltpevvkerllsprfrnrqfagllldqaflaglgnylrveilwqvgltgnh
kakdlnaaqldalahalleiprfsyatrg

SCOP Domain Coordinates for d2oq4a1:

Click to download the PDB-style file with coordinates for d2oq4a1.
(The format of our PDB-style files is described here.)

Timeline for d2oq4a1: