| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) ![]() contains a helix-two turns-helix (H2TH) motif |
| Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins) contains 4 helices in the core |
| Protein Endonuclease VIII [81703] (1 species) |
| Species Escherichia coli [TaxId:562] [81704] (8 PDB entries) Uniprot P50465 |
| Domain d2oq4a1: 2oq4 A:125-213 [148978] Other proteins in same PDB: d2oq4a2, d2oq4a3, d2oq4b2, d2oq4b3 automated match to d2ea0a1 protein/DNA complex; complexed with na, so4, zn |
PDB Entry: 2oq4 (more details), 2.6 Å
SCOPe Domain Sequences for d2oq4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oq4a1 a.156.1.2 (A:125-213) Endonuclease VIII {Escherichia coli [TaxId: 562]}
vgpdvldpnltpevvkerllsprfrnrqfagllldqaflaglgnylrveilwqvgltgnh
kakdlnaaqldalahalleiprfsyatrg
Timeline for d2oq4a1: