Lineage for d2oq0d2 (2oq0 D:13-114)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 800658Superfamily b.40.16: HIN-2000 domain-like [159141] (1 family) (S)
    duplication: tandem repeat of two OB-fold domains
  5. 800659Family b.40.16.1: HIN-200/IF120x domain [159142] (1 protein)
    Pfam PF02760
  6. 800660Protein Gamma-interferon-inducible protein Ifi-16 [159143] (1 species)
  7. 800661Species Human (Homo sapiens) [TaxId:9606] [159144] (1 PDB entry)
    Uniprot Q16666 199-301! Uniprot Q16666 302-389
  8. 800669Domain d2oq0d2: 2oq0 D:13-114 [148977]
    automatically matched to 2OQ0 A:12-114
    complexed with cl

Details for d2oq0d2

PDB Entry: 2oq0 (more details), 2 Å

PDB Description: crystal structure of the first hin-200 domain of interferon-inducible protein 16
PDB Compounds: (D:) Gamma-interferon-inducible protein Ifi-16

SCOP Domain Sequences for d2oq0d2:

Sequence, based on SEQRES records: (download)

>d2oq0d2 b.40.16.1 (D:13-114) Gamma-interferon-inducible protein Ifi-16 {Human (Homo sapiens) [TaxId: 9606]}
lqkrpvivkvlsttkpfeyetpemekkimfhatvatqtqffhvkvlntslkekfngkkii
iisdyleydsllevneestvseagpnqtfevpnkiinraket

Sequence, based on observed residues (ATOM records): (download)

>d2oq0d2 b.40.16.1 (D:13-114) Gamma-interferon-inducible protein Ifi-16 {Human (Homo sapiens) [TaxId: 9606]}
lqkrpvivkvlsttkpfeyetpemekkimfhatvatqtqffhvkvlntslkekfngkkii
iisdyleydsllevneestvsfevpnkiinraket

SCOP Domain Coordinates for d2oq0d2:

Click to download the PDB-style file with coordinates for d2oq0d2.
(The format of our PDB-style files is described here.)

Timeline for d2oq0d2: