Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.16: HIN-2000 domain-like [159141] (1 family) duplication: tandem repeat of two OB-fold domains |
Family b.40.16.1: HIN-200/IF120x domain [159142] (1 protein) Pfam PF02760 |
Protein Gamma-interferon-inducible protein Ifi-16 [159143] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159144] (1 PDB entry) Uniprot Q16666 199-301! Uniprot Q16666 302-389 |
Domain d2oq0d2: 2oq0 D:13-114 [148977] automatically matched to 2OQ0 A:12-114 complexed with cl |
PDB Entry: 2oq0 (more details), 2 Å
SCOP Domain Sequences for d2oq0d2:
Sequence, based on SEQRES records: (download)
>d2oq0d2 b.40.16.1 (D:13-114) Gamma-interferon-inducible protein Ifi-16 {Human (Homo sapiens) [TaxId: 9606]} lqkrpvivkvlsttkpfeyetpemekkimfhatvatqtqffhvkvlntslkekfngkkii iisdyleydsllevneestvseagpnqtfevpnkiinraket
>d2oq0d2 b.40.16.1 (D:13-114) Gamma-interferon-inducible protein Ifi-16 {Human (Homo sapiens) [TaxId: 9606]} lqkrpvivkvlsttkpfeyetpemekkimfhatvatqtqffhvkvlntslkekfngkkii iisdyleydsllevneestvsfevpnkiinraket
Timeline for d2oq0d2: