![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families) ![]() duplication: tandem repeat of two OB-fold domains |
![]() | Family b.40.16.1: HIN-200/IF120x domain [159142] (1 protein) Pfam PF02760 |
![]() | Protein Gamma-interferon-inducible protein Ifi-16 [159143] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [159144] (6 PDB entries) Uniprot Q16666 199-301! Uniprot Q16666 302-389 |
![]() | Domain d2oq0b2: 2oq0 B:12-114 [148973] automated match to d2oq0a2 complexed with cl |
PDB Entry: 2oq0 (more details), 2 Å
SCOPe Domain Sequences for d2oq0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oq0b2 b.40.16.1 (B:12-114) Gamma-interferon-inducible protein Ifi-16 {Human (Homo sapiens) [TaxId: 9606]} vlqkrpvivkvlsttkpfeyetpemekkimfhatvatqtqffhvkvlntslkekfngkki iiisdyleydsllevneestvseagpnqtfevpnkiinraket
Timeline for d2oq0b2: