SCOP 1.75: Domain d2oq0a2: 2oq0 A:12-114

Lineage for d2oq0a2 (2oq0 A:12-114)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.16: HIN-2000 domain-like [159141] (1 family)
   duplication: tandem repeat of two OB-fold domains

5. Family b.40.16.1: HIN-200/IF120x domain [159142] (1 protein)
   Pfam PF02760

6. Protein Gamma-interferon-inducible protein Ifi-16 [159143] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159144] (1 PDB entry)
   Uniprot Q16666 199-301! Uniprot Q16666 302-389

8. Domain d2oq0a2: 2oq0 A:12-114 [148971]
   complexed with cl

Details for d2oq0a2

PDB Entry: 2oq0, 2 Å

PDB Description: crystal structure of the first hin-200 domain of interferon-inducible protein 16

PDB Compounds: (A:) Gamma-interferon-inducible protein Ifi-16

SCOP Domain Sequences for d2oq0a2:

Sequence, based on SEQRES records:

>d2oq0a2 b.40.16.1 (A:12-114) Gamma-interferon-inducible protein Ifi-16 {Human (Homo sapiens) [TaxId: 9606]}
vlqkrpvivkvlsttkpfeyetpemekkimfhatvatqtqffhvkvlntslkekfngkki
iiisdyleydsllevneestvseagpnqtfevpnkiinraket

Sequence, based on observed residues (ATOM records):

>d2oq0a2 b.40.16.1 (A:12-114) Gamma-interferon-inducible protein Ifi-16 {Human (Homo sapiens) [TaxId: 9606]}
vlqkrpvivkvlsttkpfeyetpekkimfhatvatqtqffhvkvlntslkekfngkkiii
isdyleydsllevneestvseagpnqtfevpnkiinraket

Timeline for d2oq0a2:

• d2oq0a2 is new in SCOP 1.75
  
• d2oq0a2 appears in SCOPe 2.01
  
• d2oq0a2 appears in the current release, SCOPe 2.08