![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.227: OsmC-like [82783] (1 superfamily) swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix |
![]() | Superfamily d.227.1: OsmC-like [82784] (3 families) ![]() |
![]() | Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins) |
![]() | Protein Hypothetical protein GSU2788 [160789] (1 species) |
![]() | Species Geobacter sulfurreducens [TaxId:35554] [160790] (1 PDB entry) Uniprot Q749F5 4-185! Uniprot Q749F5 5-186 |
![]() | Domain d2oplb1: 2opl B:5-186 [148967] complexed with act, na, p6g, so4 |
PDB Entry: 2opl (more details), 1.5 Å
SCOPe Domain Sequences for d2oplb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oplb1 d.227.1.1 (B:5-186) Hypothetical protein GSU2788 {Geobacter sulfurreducens [TaxId: 35554]} tvvngvnvdqlmatieqikakpeiaqfkfratnqwmggthnqatikdfygacaeddtrkp mvfdldeppvllgenrganpveyllvalsgclttslvahaaargialrgvksryegdidl rgflglseevpvgyreirvffsidadltdgqkeelirmaqkyspvyntvakpvpvavlld rg
Timeline for d2oplb1: