SCOPe 2.08: Domain d2oplb1: 2opl B:5-186

Lineage for d2oplb1 (2opl B:5-186)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.227: OsmC-like [82783] (1 superfamily)
   swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix

4. Superfamily d.227.1: OsmC-like [82784] (3 families)

5. Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins)

6. Protein Hypothetical protein GSU2788 [160789] (1 species)

7. Species Geobacter sulfurreducens [TaxId:35554] [160790] (1 PDB entry)
   Uniprot Q749F5 4-185! Uniprot Q749F5 5-186

8. Domain d2oplb1: 2opl B:5-186 [148967]
   complexed with act, na, p6g, so4

Details for d2oplb1

PDB Entry: 2opl, 1.5 Å

PDB Description: crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2oplb1:

Sequence; same for both SEQRES and ATOM records:

>d2oplb1 d.227.1.1 (B:5-186) Hypothetical protein GSU2788 {Geobacter sulfurreducens [TaxId: 35554]}
tvvngvnvdqlmatieqikakpeiaqfkfratnqwmggthnqatikdfygacaeddtrkp
mvfdldeppvllgenrganpveyllvalsgclttslvahaaargialrgvksryegdidl
rgflglseevpvgyreirvffsidadltdgqkeelirmaqkyspvyntvakpvpvavlld
rg

Timeline for d2oplb1:

• d2oplb1 first appeared in SCOP 1.75
  
• d2oplb1 appears in SCOPe 2.07