Lineage for d2opla1 (2opl A:4-185)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613735Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 2613736Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 2613737Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins)
  6. 2613738Protein Hypothetical protein GSU2788 [160789] (1 species)
  7. 2613739Species Geobacter sulfurreducens [TaxId:35554] [160790] (1 PDB entry)
    Uniprot Q749F5 4-185! Uniprot Q749F5 5-186
  8. 2613740Domain d2opla1: 2opl A:4-185 [148966]
    complexed with act, na, p6g, so4

Details for d2opla1

PDB Entry: 2opl (more details), 1.5 Å

PDB Description: crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2opla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2opla1 d.227.1.1 (A:4-185) Hypothetical protein GSU2788 {Geobacter sulfurreducens [TaxId: 35554]}
ttvvngvnvdqlmatieqikakpeiaqfkfratnqwmggthnqatikdfygacaeddtrk
pmvfdldeppvllgenrganpveyllvalsgclttslvahaaargialrgvksryegdid
lrgflglseevpvgyreirvffsidadltdgqkeelirmaqkyspvyntvakpvpvavll
dr

SCOPe Domain Coordinates for d2opla1:

Click to download the PDB-style file with coordinates for d2opla1.
(The format of our PDB-style files is described here.)

Timeline for d2opla1: