Lineage for d2opfa1 (2opf A:125-214)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779264Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 779265Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 779340Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
    contains 4 helices in the core
  6. 779369Protein Endonuclease VIII [81703] (1 species)
  7. 779370Species Escherichia coli [TaxId:562] [81704] (8 PDB entries)
    Uniprot P50465
  8. 779374Domain d2opfa1: 2opf A:125-214 [148963]
    Other proteins in same PDB: d2opfa2, d2opfa3
    automatically matched to d1k3wa1
    complexed with gol, ped, so4, zn; mutant

Details for d2opfa1

PDB Entry: 2opf (more details), 1.85 Å

PDB Description: Crystal structure of the DNA repair enzyme endonuclease-VIII (Nei) from E. coli (R252A) in complex with AP-site containing DNA substrate
PDB Compounds: (A:) Endonuclease VIII

SCOP Domain Sequences for d2opfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2opfa1 a.156.1.2 (A:125-214) Endonuclease VIII {Escherichia coli [TaxId: 562]}
vgpdvldpnltpevvkerllsprfrnrqfagllldqaflaglgnylrveilwqvgltgnh
kakdlnaaqldalahalleiprfsyatrgq

SCOP Domain Coordinates for d2opfa1:

Click to download the PDB-style file with coordinates for d2opfa1.
(The format of our PDB-style files is described here.)

Timeline for d2opfa1: