Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species) contains an extra alpha-helical domain |
Species SARS coronavirus [TaxId:227859] [89349] (71 PDB entries) |
Domain d2op9b_: 2op9 B: [148962] Other proteins in same PDB: d2op9a3 automated match to d1q2wb_ complexed with wr1 |
PDB Entry: 2op9 (more details), 1.8 Å
SCOPe Domain Sequences for d2op9b_:
Sequence, based on SEQRES records: (download)
>d2op9b_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]} sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc s
>d2op9b_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]} sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictedmlnpnyedllirk snhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngs psgvyqcamrpnhtikgsflngscgsvgfnidycvsfcymhhmelptgvhagtdlegkfy gpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyepl tqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcs
Timeline for d2op9b_: