SCOPe 2.07: Domain d2op9a2: 2op9 A:1-301

Lineage for d2op9a2 (2op9 A:1-301)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species)
   contains an extra alpha-helical domain

7. Species SARS coronavirus [TaxId:227859] [89349] (82 PDB entries)

8. Domain d2op9a2: 2op9 A:1-301 [148961]
   Other proteins in same PDB: d2op9a3
   automated match to d1q2wb_
   complexed with wr1

Details for d2op9a2

PDB Entry: 2op9, 1.8 Å

PDB Description: substrate specificity profiling and identification of a new class of inhibitor for the major protease of the sars coronavirus

PDB Compounds: (A:) Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like proteinase (3CL-PRO, 3CLp)

SCOPe Domain Sequences for d2op9a2:

Sequence; same for both SEQRES and ATOM records:

>d2op9a2 b.47.1.4 (A:1-301) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
s

Timeline for d2op9a2:

• d2op9a2 first appeared in SCOP 1.75, called d2op9a1
  
• d2op9a2 appears in SCOPe 2.06
  
• d2op9a2 appears in the current release, SCOPe 2.08