Lineage for d2op9a2 (2op9 A:1-301)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797364Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species)
    contains an extra alpha-helical domain
  7. 2797397Species SARS coronavirus [TaxId:227859] [89349] (86 PDB entries)
  8. 2797457Domain d2op9a2: 2op9 A:1-301 [148961]
    Other proteins in same PDB: d2op9a3
    automated match to d1q2wb_
    complexed with wr1

    has additional subdomain(s) that are not in the common domain

Details for d2op9a2

PDB Entry: 2op9 (more details), 1.8 Å

PDB Description: substrate specificity profiling and identification of a new class of inhibitor for the major protease of the sars coronavirus
PDB Compounds: (A:) Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like proteinase (3CL-PRO, 3CLp)

SCOPe Domain Sequences for d2op9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2op9a2 b.47.1.4 (A:1-301) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
s

SCOPe Domain Coordinates for d2op9a2:

Click to download the PDB-style file with coordinates for d2op9a2.
(The format of our PDB-style files is described here.)

Timeline for d2op9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2op9a3
View in 3D
Domains from other chains:
(mouse over for more information)
d2op9b_