SCOP 1.75: Domain d2op5f1: 2op5 F:7-114

Lineage for d2op5f1 (2op5 F:7-114)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (23 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.22: Marine metagenome family DABB1 [160301] (2 proteins)

6. Protein Hypothetical protein GOS_7213774 [160302] (1 species)

7. Species environmental samples [TaxId:33858] [160303] (1 PDB entry)
   marine metagenome

8. Domain d2op5f1: 2op5 F:7-114 [148959]
   automatically matched to 2OP5 A:4-115
   complexed with edo

Details for d2op5f1

PDB Entry: 2op5, 2.2 Å

PDB Description: crystal structure of a dimeric ferredoxin-like protein (jcvi_pep_1096672785533) from uncultured marine organism at 2.20 a resolution

PDB Compounds: (F:) hypothetical protein

SCOP Domain Sequences for d2op5f1:

Sequence; same for both SEQRES and ATOM records:

>d2op5f1 d.58.4.22 (F:7-114) Hypothetical protein GOS_7213774 {environmental samples}
taflnslfmdftsenelelflksldevwsedlysrlsaaglirhviskvwnkeqhrismv
feydskegyqkcqeiidkefgitlkeklkkfvfkihnnrgvvvsefir

Timeline for d2op5f1:

• d2op5f1 is new in SCOP 1.75
  
• d2op5f1 appears in SCOPe 2.01
  
• d2op5f1 appears in the current release, SCOPe 2.08