| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
| Family d.58.4.22: Marine metagenome family DABB1 [160301] (2 proteins) |
| Protein Hypothetical protein GOS_7213774 [160302] (1 species) |
| Species Environmental samples [TaxId:33858] [160303] (1 PDB entry) marine metagenome |
| Domain d2op5f1: 2op5 F:7-114 [148959] automatically matched to 2OP5 A:4-115 complexed with edo |
PDB Entry: 2op5 (more details), 2.2 Å
SCOPe Domain Sequences for d2op5f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2op5f1 d.58.4.22 (F:7-114) Hypothetical protein GOS_7213774 {Environmental samples [TaxId: 33858]}
taflnslfmdftsenelelflksldevwsedlysrlsaaglirhviskvwnkeqhrismv
feydskegyqkcqeiidkefgitlkeklkkfvfkihnnrgvvvsefir
Timeline for d2op5f1: