SCOPe 2.08: Domain d2op5c1: 2op5 C:4-115

Lineage for d2op5c1 (2op5 C:4-115)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.22: Marine metagenome family DABB1 [160301] (2 proteins)

6. Protein Hypothetical protein GOS_7213774 [160302] (1 species)

7. Species Environmental samples [TaxId:33858] [160303] (1 PDB entry)
   marine metagenome

8. Domain d2op5c1: 2op5 C:4-115 [148956]
   automatically matched to 2OP5 A:4-115
   complexed with edo

Details for d2op5c1

PDB Entry: 2op5, 2.2 Å

PDB Description: crystal structure of a dimeric ferredoxin-like protein (jcvi_pep_1096672785533) from uncultured marine organism at 2.20 a resolution

PDB Compounds: (C:) hypothetical protein

SCOPe Domain Sequences for d2op5c1:

Sequence, based on SEQRES records:

>d2op5c1 d.58.4.22 (C:4-115) Hypothetical protein GOS_7213774 {Environmental samples [TaxId: 33858]}
tdetaflnslfmdftsenelelflksldevwsedlysrlsaaglirhviskvwnkeqhri
smvfeydskegyqkcqeiidkefgitlkeklkkfvfkihnnrgvvvsefirs

Sequence, based on observed residues (ATOM records):

>d2op5c1 d.58.4.22 (C:4-115) Hypothetical protein GOS_7213774 {Environmental samples [TaxId: 33858]}
tdetaflnslfmdftsenelelflksldevwsedlysrlsaaglirhviskvwneqhris
mvfeydskegyqkcqeiidkefgitlkeklkkfvfkihnnrgvvvsefirs

Timeline for d2op5c1:

• d2op5c1 first appeared in SCOP 1.75
  
• d2op5c1 appears in SCOPe 2.07