Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.22: Marine metagenome family DABB1 [160301] (2 proteins) |
Protein Hypothetical protein GOS_7213774 [160302] (1 species) |
Species Environmental samples [TaxId:33858] [160303] (1 PDB entry) marine metagenome |
Domain d2op5b1: 2op5 B:8-115 [148955] automatically matched to 2OP5 A:4-115 complexed with edo |
PDB Entry: 2op5 (more details), 2.2 Å
SCOPe Domain Sequences for d2op5b1:
Sequence, based on SEQRES records: (download)
>d2op5b1 d.58.4.22 (B:8-115) Hypothetical protein GOS_7213774 {Environmental samples [TaxId: 33858]} aflnslfmdftsenelelflksldevwsedlysrlsaaglirhviskvwnkeqhrismvf eydskegyqkcqeiidkefgitlkeklkkfvfkihnnrgvvvsefirs
>d2op5b1 d.58.4.22 (B:8-115) Hypothetical protein GOS_7213774 {Environmental samples [TaxId: 33858]} aflnslfmdftsenelelflksldevwsedlysrlsaaglirhviskvwneqhrismvfe ydskegyqkcqeiidkefgitlkeklkkfvfkihnnrgvvvsefirs
Timeline for d2op5b1: