Lineage for d2op5a1 (2op5 A:4-115)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950135Family d.58.4.22: Marine metagenome family DABB1 [160301] (2 proteins)
  6. 2950142Protein Hypothetical protein GOS_7213774 [160302] (1 species)
  7. 2950143Species Environmental samples [TaxId:33858] [160303] (1 PDB entry)
    marine metagenome
  8. 2950144Domain d2op5a1: 2op5 A:4-115 [148954]
    complexed with edo

Details for d2op5a1

PDB Entry: 2op5 (more details), 2.2 Å

PDB Description: crystal structure of a dimeric ferredoxin-like protein (jcvi_pep_1096672785533) from uncultured marine organism at 2.20 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2op5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2op5a1 d.58.4.22 (A:4-115) Hypothetical protein GOS_7213774 {Environmental samples [TaxId: 33858]}
tdetaflnslfmdftsenelelflksldevwsedlysrlsaaglirhviskvwnkeqhri
smvfeydskegyqkcqeiidkefgitlkeklkkfvfkihnnrgvvvsefirs

SCOPe Domain Coordinates for d2op5a1:

Click to download the PDB-style file with coordinates for d2op5a1.
(The format of our PDB-style files is described here.)

Timeline for d2op5a1: