![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.353: AMPKBI-like [160218] (1 superfamily) comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions |
![]() | Superfamily d.353.1: AMPKBI-like [160219] (1 family) ![]() automatically mapped to Pfam PF04739 |
![]() | Family d.353.1.1: AMPKBI-like [160220] (4 proteins) Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region |
![]() | Protein AMP-activated protein kinase beta subunit [160225] (1 species) |
![]() | Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [160226] (2 PDB entries) Uniprot P78789 205-297 Spcc1919.03c |
![]() | Domain d2ooyd_: 2ooy D: [148949] Other proteins in same PDB: d2ooya_, d2ooyc_, d2ooye1, d2ooye2, d2ooye3, d2ooyg1, d2ooyg2, d2ooyg3 automated match to d2ooxb1 complexed with atp, flc |
PDB Entry: 2ooy (more details), 2.88 Å
SCOPe Domain Sequences for d2ooyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ooyd_ d.353.1.1 (D:) AMP-activated protein kinase beta subunit {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} qysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnhla aantqlgvlalsattryhrkyvttamfknfd
Timeline for d2ooyd_: