Lineage for d2ooyd_ (2ooy D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011443Fold d.353: AMPKBI-like [160218] (1 superfamily)
    comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions
  4. 3011444Superfamily d.353.1: AMPKBI-like [160219] (1 family) (S)
    automatically mapped to Pfam PF04739
  5. 3011445Family d.353.1.1: AMPKBI-like [160220] (4 proteins)
    Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region
  6. 3011449Protein AMP-activated protein kinase beta subunit [160225] (1 species)
  7. 3011450Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [160226] (2 PDB entries)
    Uniprot P78789 205-297
    Spcc1919.03c
  8. 3011454Domain d2ooyd_: 2ooy D: [148949]
    Other proteins in same PDB: d2ooya_, d2ooyc_, d2ooye1, d2ooye2, d2ooye3, d2ooyg1, d2ooyg2, d2ooyg3
    automated match to d2ooxb1
    complexed with atp, flc

Details for d2ooyd_

PDB Entry: 2ooy (more details), 2.88 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase complexed with ATP
PDB Compounds: (D:) SPCC1919.03c protein

SCOPe Domain Sequences for d2ooyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ooyd_ d.353.1.1 (D:) AMP-activated protein kinase beta subunit {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
qysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnhla
aantqlgvlalsattryhrkyvttamfknfd

SCOPe Domain Coordinates for d2ooyd_:

Click to download the PDB-style file with coordinates for d2ooyd_.
(The format of our PDB-style files is described here.)

Timeline for d2ooyd_: