Lineage for d2ooya_ (2ooy A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2215471Superfamily d.129.6: KA1-like [103243] (3 families) (S)
    contains a single copy of this fold
  5. 2215480Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins)
    PfamB PB166430
  6. 2215488Protein Snf1-like protein kinase ssp2 [160726] (1 species)
  7. 2215489Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [160727] (6 PDB entries)
    Uniprot O74536 449-576
  8. 2215500Domain d2ooya_: 2ooy A: [148946]
    Other proteins in same PDB: d2ooyb_, d2ooyd_, d2ooye1, d2ooye2, d2ooye3, d2ooyg1, d2ooyg2, d2ooyg3
    automated match to d2ooxa1
    complexed with atp, flc

Details for d2ooya_

PDB Entry: 2ooy (more details), 2.88 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase complexed with ATP
PDB Compounds: (A:) SNF1-like protein kinase ssp2

SCOPe Domain Sequences for d2ooya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ooya_ d.129.6.2 (A:) Snf1-like protein kinase ssp2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
srrnkwhfgvrcrgdapeillavyralqragaqftvpkpvngkyrsdmytiksrweiphc
kregkntyayielqlyevmpgcfmldvksngykdiyshpertadhgmddlkssfpfldlc
amlvcklfs

SCOPe Domain Coordinates for d2ooya_:

Click to download the PDB-style file with coordinates for d2ooya_.
(The format of our PDB-style files is described here.)

Timeline for d2ooya_: