Lineage for d2ooxb1 (2oox B:205-297)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1948489Fold d.353: AMPKBI-like [160218] (1 superfamily)
    comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions
  4. 1948490Superfamily d.353.1: AMPKBI-like [160219] (1 family) (S)
    automatically mapped to Pfam PF04739
  5. 1948491Family d.353.1.1: AMPKBI-like [160220] (4 proteins)
    Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region
  6. 1948495Protein AMP-activated protein kinase beta subunit [160225] (1 species)
  7. 1948496Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [160226] (2 PDB entries)
    Uniprot P78789 205-297
    Spcc1919.03c
  8. 1948497Domain d2ooxb1: 2oox B:205-297 [148941]
    Other proteins in same PDB: d2ooxa1, d2ooxc_, d2ooxe1, d2ooxe2, d2ooxg1, d2ooxg2
    complexed with amp

Details for d2ooxb1

PDB Entry: 2oox (more details), 2.6 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase complexed with AMP
PDB Compounds: (B:) SPCC1919.03c protein

SCOPe Domain Sequences for d2ooxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ooxb1 d.353.1.1 (B:205-297) AMP-activated protein kinase beta subunit {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
seqysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnh
laaantqlgvlalsattryhrkyvttamfknfd

SCOPe Domain Coordinates for d2ooxb1:

Click to download the PDB-style file with coordinates for d2ooxb1.
(The format of our PDB-style files is described here.)

Timeline for d2ooxb1: