![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.13: SpoIIaa-like [52086] (2 superfamilies) core: 4 turns of a (beta-alpha)n superhelix |
![]() | Superfamily c.13.2: SpoIIaa-like [52091] (3 families) ![]() |
![]() | Family c.13.2.2: Sfri0576-like [159456] (2 proteins) significant structural variability despite high sequence similarity automatically mapped to Pfam PF11964 |
![]() | Protein Hypothetical protein Sfri0576 [159459] (1 species) |
![]() | Species Shewanella frigidimarina [TaxId:56812] [159460] (1 PDB entry) Uniprot Q087X8 2-126 |
![]() | Domain d2ookb_: 2ook B: [148931] automated match to d2ooka1 complexed with edo |
PDB Entry: 2ook (more details), 1.8 Å
SCOPe Domain Sequences for d2ookb_:
Sequence, based on SEQRES records: (download)
>d2ookb_ c.13.2.2 (B:) Hypothetical protein Sfri0576 {Shewanella frigidimarina [TaxId: 56812]} mkkhglsiginriesvffvtlkaigtlthedylvitpmlegalsqvdqpkvslfldatel dgwdlraawddlklglkhksefervailgnkdwqewaakigswfiageikyfededdalk wlry
>d2ookb_ c.13.2.2 (B:) Hypothetical protein Sfri0576 {Shewanella frigidimarina [TaxId: 56812]} mkkhglsiginriesvffvtlkaigtlthedylvitpmlegalsqvdqpkvslfldatel dgwdlraawddlklglksefervailgnkdwqewaakigswfiageikyfededdalkwl ry
Timeline for d2ookb_: