SCOPe 2.08: Domain d2ookb_: 2ook B:

Lineage for d2ookb_ (2ook B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.2: SpoIIaa-like [52091] (3 families)

5. Family c.13.2.2: Sfri0576-like [159456] (2 proteins)
   significant structural variability despite high sequence similarity
   automatically mapped to Pfam PF11964

6. Protein Hypothetical protein Sfri0576 [159459] (1 species)

7. Species Shewanella frigidimarina [TaxId:56812] [159460] (1 PDB entry)
   Uniprot Q087X8 2-126

8. Domain d2ookb_: 2ook B: [148931]
   automated match to d2ooka1
   complexed with edo

Details for d2ookb_

PDB Entry: 2ook, 1.8 Å

PDB Description: crystal structure of a protein with unknown function (yp_749275.1) from shewanella frigidimarina ncimb 400 at 1.80 a resolution

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2ookb_:

Sequence, based on SEQRES records:

>d2ookb_ c.13.2.2 (B:) Hypothetical protein Sfri0576 {Shewanella frigidimarina [TaxId: 56812]}
mkkhglsiginriesvffvtlkaigtlthedylvitpmlegalsqvdqpkvslfldatel
dgwdlraawddlklglkhksefervailgnkdwqewaakigswfiageikyfededdalk
wlry

Sequence, based on observed residues (ATOM records):

>d2ookb_ c.13.2.2 (B:) Hypothetical protein Sfri0576 {Shewanella frigidimarina [TaxId: 56812]}
mkkhglsiginriesvffvtlkaigtlthedylvitpmlegalsqvdqpkvslfldatel
dgwdlraawddlklglksefervailgnkdwqewaakigswfiageikyfededdalkwl
ry

Timeline for d2ookb_:

• d2ookb_ first appeared in SCOP 1.75, called d2ookb1
  
• d2ookb_ appears in SCOPe 2.07