Lineage for d2ookb_ (2ook B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099015Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 2099063Superfamily c.13.2: SpoIIaa-like [52091] (2 families) (S)
  5. 2099089Family c.13.2.2: Sfri0576-like [159456] (2 protein domains)
    significant structural variability despite high sequence similarity
    automatically mapped to Pfam PF11964
  6. 2099090Protein Hypothetical protein Sfri0576 [159459] (1 species)
  7. 2099091Species Shewanella frigidimarina [TaxId:56812] [159460] (1 PDB entry)
    Uniprot Q087X8 2-126
  8. 2099093Domain d2ookb_: 2ook B: [148931]
    automated match to d2ooka1
    complexed with edo

Details for d2ookb_

PDB Entry: 2ook (more details), 1.8 Å

PDB Description: crystal structure of a protein with unknown function (yp_749275.1) from shewanella frigidimarina ncimb 400 at 1.80 a resolution
PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2ookb_:

Sequence, based on SEQRES records: (download)

>d2ookb_ c.13.2.2 (B:) Hypothetical protein Sfri0576 {Shewanella frigidimarina [TaxId: 56812]}
mkkhglsiginriesvffvtlkaigtlthedylvitpmlegalsqvdqpkvslfldatel
dgwdlraawddlklglkhksefervailgnkdwqewaakigswfiageikyfededdalk
wlry

Sequence, based on observed residues (ATOM records): (download)

>d2ookb_ c.13.2.2 (B:) Hypothetical protein Sfri0576 {Shewanella frigidimarina [TaxId: 56812]}
mkkhglsiginriesvffvtlkaigtlthedylvitpmlegalsqvdqpkvslfldatel
dgwdlraawddlklglksefervailgnkdwqewaakigswfiageikyfededdalkwl
ry

SCOPe Domain Coordinates for d2ookb_:

Click to download the PDB-style file with coordinates for d2ookb_.
(The format of our PDB-style files is described here.)

Timeline for d2ookb_: