SCOPe 2.08: Domain d2ooka1: 2ook A:2-126

Lineage for d2ooka1 (2ook A:2-126)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.2: SpoIIaa-like [52091] (3 families)

5. Family c.13.2.2: Sfri0576-like [159456] (2 proteins)
   significant structural variability despite high sequence similarity
   automatically mapped to Pfam PF11964

6. Protein Hypothetical protein Sfri0576 [159459] (1 species)

7. Species Shewanella frigidimarina [TaxId:56812] [159460] (1 PDB entry)
   Uniprot Q087X8 2-126

8. Domain d2ooka1: 2ook A:2-126 [148930]
   complexed with edo

Details for d2ooka1

PDB Entry: 2ook, 1.8 Å

PDB Description: crystal structure of a protein with unknown function (yp_749275.1) from shewanella frigidimarina ncimb 400 at 1.80 a resolution

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2ooka1:

Sequence; same for both SEQRES and ATOM records:

>d2ooka1 c.13.2.2 (A:2-126) Hypothetical protein Sfri0576 {Shewanella frigidimarina [TaxId: 56812]}
dmkkhglsiginriesvffvtlkaigtlthedylvitpmlegalsqvdqpkvslfldate
ldgwdlraawddlklglkhksefervailgnkdwqewaakigswfiageikyfededdal
kwlry

Timeline for d2ooka1:

• d2ooka1 first appeared in SCOP 1.75
  
• d2ooka1 appears in SCOPe 2.07