Lineage for d2ooka1 (2ook A:2-126)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852201Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 2852253Superfamily c.13.2: SpoIIaa-like [52091] (3 families) (S)
  5. 2852279Family c.13.2.2: Sfri0576-like [159456] (2 proteins)
    significant structural variability despite high sequence similarity
    automatically mapped to Pfam PF11964
  6. 2852280Protein Hypothetical protein Sfri0576 [159459] (1 species)
  7. 2852281Species Shewanella frigidimarina [TaxId:56812] [159460] (1 PDB entry)
    Uniprot Q087X8 2-126
  8. 2852282Domain d2ooka1: 2ook A:2-126 [148930]
    complexed with edo

Details for d2ooka1

PDB Entry: 2ook (more details), 1.8 Å

PDB Description: crystal structure of a protein with unknown function (yp_749275.1) from shewanella frigidimarina ncimb 400 at 1.80 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2ooka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ooka1 c.13.2.2 (A:2-126) Hypothetical protein Sfri0576 {Shewanella frigidimarina [TaxId: 56812]}
dmkkhglsiginriesvffvtlkaigtlthedylvitpmlegalsqvdqpkvslfldate
ldgwdlraawddlklglkhksefervailgnkdwqewaakigswfiageikyfededdal
kwlry

SCOPe Domain Coordinates for d2ooka1:

Click to download the PDB-style file with coordinates for d2ooka1.
(The format of our PDB-style files is described here.)

Timeline for d2ooka1: