SCOPe 2.05: Domain d2oojb_: 2ooj B:

Lineage for d2oojb_ (2ooj B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.159: AOC barrel-like [141492] (2 superfamilies)
   barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds

4. Superfamily b.159.2: SO1590-like [159238] (1 family)
   automatically mapped to Pfam PF11528

5. Family b.159.2.1: SO1590-like [159239] (2 proteins)

6. Protein Hypothetical protein SO1590 [159240] (1 species)

7. Species Shewanella oneidensis [TaxId:70863] [159241] (1 PDB entry)
   Uniprot Q8EGL1 2-134

8. Domain d2oojb_: 2ooj B: [148929]
   automated match to d2ooja1
   complexed with act

Details for d2oojb_

PDB Entry: 2ooj, 1.84 Å

PDB Description: crystal structure of a protein with unknown function from duf3224 family (so_1590) from shewanella oneidensis mr-1 at 1.84 a resolution

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2oojb_:

Sequence; same for both SEQRES and ATOM records:

>d2oojb_ b.159.2.1 (B:) Hypothetical protein SO1590 {Shewanella oneidensis [TaxId: 70863]}
memtkvtgkfdvkltpenayatgvggvnlgrmaldktfygelearsqgemlsamtavkgs
agyvaieqvvgklcgrqgsfvlqhfgimtdgqnrlhlevvphsgageltglygtmaisie
ngqhfyefsfcfepa

Timeline for d2oojb_:

• d2oojb_ first appeared in SCOP 1.75, called d2oojb1
  
• d2oojb_ appears in SCOPe 2.04
  
• d2oojb_ appears in SCOPe 2.06
  
• d2oojb_ appears in the current release, SCOPe 2.08