![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.159: AOC barrel-like [141492] (2 superfamilies) barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds |
![]() | Superfamily b.159.2: SO1590-like [159238] (1 family) ![]() automatically mapped to Pfam PF11528 |
![]() | Family b.159.2.1: SO1590-like [159239] (2 proteins) |
![]() | Protein Hypothetical protein SO1590 [159240] (1 species) |
![]() | Species Shewanella oneidensis [TaxId:70863] [159241] (1 PDB entry) Uniprot Q8EGL1 2-134 |
![]() | Domain d2oojb_: 2ooj B: [148929] automated match to d2ooja1 complexed with act |
PDB Entry: 2ooj (more details), 1.84 Å
SCOPe Domain Sequences for d2oojb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oojb_ b.159.2.1 (B:) Hypothetical protein SO1590 {Shewanella oneidensis [TaxId: 70863]} memtkvtgkfdvkltpenayatgvggvnlgrmaldktfygelearsqgemlsamtavkgs agyvaieqvvgklcgrqgsfvlqhfgimtdgqnrlhlevvphsgageltglygtmaisie ngqhfyefsfcfepa
Timeline for d2oojb_: