Lineage for d2ooja1 (2ooj A:2-134)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089274Fold b.159: AOC barrel-like [141492] (2 superfamilies)
    barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds
  4. 2089347Superfamily b.159.2: SO1590-like [159238] (1 family) (S)
    automatically mapped to Pfam PF11528
  5. 2089348Family b.159.2.1: SO1590-like [159239] (2 proteins)
  6. 2089349Protein Hypothetical protein SO1590 [159240] (1 species)
  7. 2089350Species Shewanella oneidensis [TaxId:70863] [159241] (1 PDB entry)
    Uniprot Q8EGL1 2-134
  8. 2089351Domain d2ooja1: 2ooj A:2-134 [148928]
    complexed with act

Details for d2ooja1

PDB Entry: 2ooj (more details), 1.84 Å

PDB Description: crystal structure of a protein with unknown function from duf3224 family (so_1590) from shewanella oneidensis mr-1 at 1.84 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2ooja1:

Sequence, based on SEQRES records: (download)

>d2ooja1 b.159.2.1 (A:2-134) Hypothetical protein SO1590 {Shewanella oneidensis [TaxId: 70863]}
emtkvtgkfdvkltpenayatgvggvnlgrmaldktfygelearsqgemlsamtavkgsa
gyvaieqvvgklcgrqgsfvlqhfgimtdgqnrlhlevvphsgageltglygtmaisien
gqhfyefsfcfep

Sequence, based on observed residues (ATOM records): (download)

>d2ooja1 b.159.2.1 (A:2-134) Hypothetical protein SO1590 {Shewanella oneidensis [TaxId: 70863]}
emtkvtgkfdvkltpenayatgvggvnlgrmaldktfygelearsqgemlsamtavkgsa
gyvaieqvvgklcgrqgsfvlqhfgimtdnrlhlevvphsgageltglygtmaisiengq
hfyefsfcfep

SCOPe Domain Coordinates for d2ooja1:

Click to download the PDB-style file with coordinates for d2ooja1.
(The format of our PDB-style files is described here.)

Timeline for d2ooja1: