SCOP 1.75: Domain d2ooib1: 2ooi B:73-233

Lineage for d2ooib1 (2ooi B:73-233)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
   duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654

4. Superfamily d.190.1: Chorismate lyase-like [64288] (3 families)

5. Family d.190.1.2: UTRA domain [143473] (10 proteins)
   Pfam PF07702

6. Protein Hypothetical protein SA0254 [160405] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [160406] (1 PDB entry)
   Uniprot Q7A7U1 73-233

8. Domain d2ooib1: 2ooi B:73-233 [148927]
   automatically matched to 2OOI A:73-233
   complexed with zn

Details for d2ooib1

PDB Entry: 2ooi, 2.6 Å

PDB Description: The crystal structure of gene product SA0254 from Staphylocococcus aureus subsp. aureus N315

PDB Compounds: (B:) SA0254 protein

SCOP Domain Sequences for d2ooib1:

Sequence, based on SEQRES records:

>d2ooib1 d.190.1.2 (B:73-233) Hypothetical protein SA0254 {Staphylococcus aureus [TaxId: 1280]}
nrinvfktngfskslgehrmtskvlvfkematppksvqdelqlnaddtvyylerlrfvdd
dvlcieysyyhkeivkylnddiakgsifdylesnmklrigfsdiffnvdkltsseasllq
lstgepclryhqtfytmtgkpfdssdivfhyrhaqfyipsk

Sequence, based on observed residues (ATOM records):

>d2ooib1 d.190.1.2 (B:73-233) Hypothetical protein SA0254 {Staphylococcus aureus [TaxId: 1280]}
nrinvfktngfskslgrmtskvlvfkematppksvqdelqlnadtvyylerlrfvdddvl
cieysyyhkeivkylnddiakgsifdylesnmklrigfsdiffnvdkltsseasllqlst
gepclryhqtfytmtgkpfdssdivfhyrhaqfyipsk

Timeline for d2ooib1:

• d2ooib1 is new in SCOP 1.75
  
• d2ooib1 is called d2ooib_ in SCOPe 2.01
  
• d2ooib1 appears in the current release, SCOPe 2.08, called d2ooib_