Lineage for d2ooib_ (2ooi B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005715Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
    duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654
  4. 3005716Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) (S)
  5. 3005731Family d.190.1.2: UTRA domain [143473] (11 proteins)
    Pfam PF07702
  6. 3005742Protein Hypothetical protein SA0254 [160405] (1 species)
  7. 3005743Species Staphylococcus aureus [TaxId:1280] [160406] (1 PDB entry)
    Uniprot Q7A7U1 73-233
  8. 3005745Domain d2ooib_: 2ooi B: [148927]
    automated match to d2ooia1
    complexed with zn

Details for d2ooib_

PDB Entry: 2ooi (more details), 2.6 Å

PDB Description: The crystal structure of gene product SA0254 from Staphylocococcus aureus subsp. aureus N315
PDB Compounds: (B:) SA0254 protein

SCOPe Domain Sequences for d2ooib_:

Sequence, based on SEQRES records: (download)

>d2ooib_ d.190.1.2 (B:) Hypothetical protein SA0254 {Staphylococcus aureus [TaxId: 1280]}
nrinvfktngfskslgehrmtskvlvfkematppksvqdelqlnaddtvyylerlrfvdd
dvlcieysyyhkeivkylnddiakgsifdylesnmklrigfsdiffnvdkltsseasllq
lstgepclryhqtfytmtgkpfdssdivfhyrhaqfyipsk

Sequence, based on observed residues (ATOM records): (download)

>d2ooib_ d.190.1.2 (B:) Hypothetical protein SA0254 {Staphylococcus aureus [TaxId: 1280]}
nrinvfktngfskslgrmtskvlvfkematppksvqdelqlnadtvyylerlrfvdddvl
cieysyyhkeivkylnddiakgsifdylesnmklrigfsdiffnvdkltsseasllqlst
gepclryhqtfytmtgkpfdssdivfhyrhaqfyipsk

SCOPe Domain Coordinates for d2ooib_:

Click to download the PDB-style file with coordinates for d2ooib_.
(The format of our PDB-style files is described here.)

Timeline for d2ooib_: