SCOP 1.75: Domain d2oofa2: 2oof A:66-366

Lineage for d2oofa2 (2oof A:66-366)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.17: Imidazolonepropionase-like [159400] (3 proteins)

6. Protein Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 [159403] (1 species)

7. Species Environmental samples [TaxId:33858] [159404] (2 PDB entries)
   marine metagenome

8. Domain d2oofa2: 2oof A:66-366 [148925]
   Other proteins in same PDB: d2oofa1
   complexed with fe

Details for d2oofa2

PDB Entry: 2oof, 2.2 Å

PDB Description: the crystal structure of 4-imidazolone-5-propanoate amidohydrolase from environmental sample

PDB Compounds: (A:) 4-imidazolone-5-propanoate amidohydrolase

SCOP Domain Sequences for d2oofa2:

Sequence; same for both SEQRES and ATOM records:

>d2oofa2 c.1.9.17 (A:66-366) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples}
pglidchthlifagsraeefelrqkgvpyaeiarkgggiistvratraasedqlfelalp
rvksliregvttveiksgygltledelkmlrvarrlgealpirvkttllaahavppeyrd
dpdswveticqeiipaaaeagladavdvfcehigfslaqteqvylaadqyglavkghmdq
lsnlggstlaanfgalsvdhleyldpegiqalahrgvvatllptafyflketklppvval
rkagvpmavssdinpgtapivslrmamnmactlfgltpveamagvtrhaaralgeqeqlg
q

Timeline for d2oofa2:

• d2oofa2 is new in SCOP 1.75
  
• d2oofa2 appears in SCOPe 2.01
  
• d2oofa2 appears in the current release, SCOPe 2.08