![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.17: Imidazolonepropionase-like [159400] (3 proteins) automatically mapped to Pfam PF13147 |
![]() | Protein Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 [159403] (1 species) |
![]() | Species Environmental samples [TaxId:33858] [159404] (2 PDB entries) marine metagenome |
![]() | Domain d2oofa2: 2oof A:66-366 [148925] Other proteins in same PDB: d2oofa1 complexed with fe |
PDB Entry: 2oof (more details), 2.2 Å
SCOPe Domain Sequences for d2oofa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oofa2 c.1.9.17 (A:66-366) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples [TaxId: 33858]} pglidchthlifagsraeefelrqkgvpyaeiarkgggiistvratraasedqlfelalp rvksliregvttveiksgygltledelkmlrvarrlgealpirvkttllaahavppeyrd dpdswveticqeiipaaaeagladavdvfcehigfslaqteqvylaadqyglavkghmdq lsnlggstlaanfgalsvdhleyldpegiqalahrgvvatllptafyflketklppvval rkagvpmavssdinpgtapivslrmamnmactlfgltpveamagvtrhaaralgeqeqlg q
Timeline for d2oofa2: