SCOPe 2.08: Domain d2oofa1: 2oof A:3-65,A:367-407

Lineage for d2oofa1 (2oof A:3-65,A:367-407)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.10: Imidazolonepropionase-like [159347] (3 proteins)

6. Protein Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 [159351] (1 species)

7. Species Environmental samples [TaxId:33858] [159352] (2 PDB entries)
   marine metagenome

8. Domain d2oofa1: 2oof A:3-65,A:367-407 [148924]
   Other proteins in same PDB: d2oofa2
   complexed with fe

Details for d2oofa1

PDB Entry: 2oof, 2.2 Å

PDB Description: the crystal structure of 4-imidazolone-5-propanoate amidohydrolase from environmental sample

PDB Compounds: (A:) 4-imidazolone-5-propanoate amidohydrolase

SCOPe Domain Sequences for d2oofa1:

Sequence, based on SEQRES records:

>d2oofa1 b.92.1.10 (A:3-65,A:367-407) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples [TaxId: 33858]}
lncervwlnvtpatlrsdladygllephalgvhegrihalvpmqdlkgpypahwqdmkgk
lvtXlrvgmladflvwncghpaelsyligvdqlvsrvvngeetlh

Sequence, based on observed residues (ATOM records):

>d2oofa1 b.92.1.10 (A:3-65,A:367-407) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples [TaxId: 33858]}
lncervwlnvtpatlrsdladygllephalgvhegrihalvpmqdlkypahwqdmkgklv
tXlrvgmladflvwncghpaelsyligvdqlvsrvvngeetlh

Timeline for d2oofa1:

• d2oofa1 first appeared in SCOP 1.75
  
• d2oofa1 appears in SCOPe 2.07