Lineage for d2ooea1 (2ooe A:21-549)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2334020Family a.118.8.7: HAT/Suf repeat [158782] (4 protein domains)
    includes Pfam PF05843
    Pfam PF02184
  6. 2334021Protein Cleavage stimulation factor 77 kDa subunit CSTF3 [158783] (1 species)
  7. 2334022Species Mouse (Mus musculus) [TaxId:10090] [158784] (2 PDB entries)
    Uniprot Q99LI7 21-549! Uniprot Q99LI7 242-549
  8. 2334025Domain d2ooea1: 2ooe A:21-549 [148923]

Details for d2ooea1

PDB Entry: 2ooe (more details), 3 Å

PDB Description: crystal structure of hat domain of murine cstf-77
PDB Compounds: (A:) Cleavage stimulation factor 77 kDa subunit

SCOPe Domain Sequences for d2ooea1:

Sequence, based on SEQRES records: (download)

>d2ooea1 a.118.8.7 (A:21-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}
aekkleenpydldawsilireaqnqpidkarktyerlvaqfpssgrfwklyieaeikakn
ydkveklfqrclmkvlhidlwkcylsyvretkgklpsykekmaqaydfaldkigmeimsy
qiwvdyinflkgveavgsyaenqritavrrvyqrgcvnpminieqlwrdynkyeeginih
lakkmiedrsrdymnarrvakeyetvmkgldrnapsvppqntpqeaqqvdmwkkyiqwek
snplrtedqtlitkrvmfayeqcllvlghhpdiwyeaaqyleqsskllaekgdmnnaklf
sdeaaniyeraistllkknmllyfayadyeesrmkyekvhsiynrllaiedidptlvyiq
ymkfarraegiksgrmifkkaredartrhhvyvtaalmeyycskdksvafkifelglkky
gdipeyvlayidylshlnednntrvlfervltsgslppeksgeiwarflafesnigdlas
ilkvekrrftafreeyegketallvdrykfmdlypcsaselkalgykdv

Sequence, based on observed residues (ATOM records): (download)

>d2ooea1 a.118.8.7 (A:21-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}
aekkleenpydldawsilireaqnqpidkarktyerlvaqfpssgrfwklyieaeikakn
ydkveklfqrclmkvlhidlwkcylsyvretkgklpsykekmaqaydfaldkigmeimsy
qiwvdyinflkgveavgsyaenqritavrrvyqrgcvnpminieqlwrdynkyeeginih
lakkmiedrsrdymnarrvakeyetvmkgldrnapsvppqpqeaqqvdmwkkyiqweksn
plrtedqtlitkrvmfayeqcllvlghhpdiwyeaaqyleqsskllaekgdmnnaklfsd
eaaniyeraistllkknmllyfayadyeesrmkyekvhsiynrllaiedidptlvyiqym
kfarraegiksgrmifkkaredartrhhvyvtaalmeyycskdksvafkifelglkkygd
ipeyvlayidylshlnednntrvlfervltsgslppeksgeiwarflafesnigdlasil
kvekrrftafreeyegketallvdrykfmdlypcsaselkalgykdv

SCOPe Domain Coordinates for d2ooea1:

Click to download the PDB-style file with coordinates for d2ooea1.
(The format of our PDB-style files is described here.)

Timeline for d2ooea1: