Lineage for d2ooda2 (2ood A:73-397)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833861Family c.1.9.9: SAH/MTA deaminase-like [82258] (3 proteins)
    automatically mapped to Pfam PF01979
  6. 2833862Protein Guanine deaminase [159391] (3 species)
  7. 2833863Species Bradyrhizobium japonicum [TaxId:375] [159393] (1 PDB entry)
    Uniprot Q89NG0 71-395
    Blr3880
  8. 2833864Domain d2ooda2: 2ood A:73-397 [148922]
    Other proteins in same PDB: d2ooda1, d2ooda3
    complexed with gun, zn

Details for d2ooda2

PDB Entry: 2ood (more details), 2.62 Å

PDB Description: crystal structure of guanine deaminase from bradyrhizobium japonicum
PDB Compounds: (A:) Blr3880 protein

SCOPe Domain Sequences for d2ooda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ooda2 c.1.9.9 (A:73-397) Guanine deaminase {Bradyrhizobium japonicum [TaxId: 375]}
pgfidghihlpqtrvlgaygeqllpwlqksiypeeikykdrnyaregvkrfldallaagt
ttcqaftssspvateelfeeasrrnmrviagltgidrnapaefidtpenfyrdskrliaq
yhdkgrnlyaitprfafgaspellkacqrlkhehpdcwvnthisenpaecsgvlvehpdc
qdylgvyekfdlvgpkfsgghgvylsnnefrrmskkgaavvfcpcsnlflgsglfrlgra
tdpehrvkmsfgtdvgggnrfsmisvlddaykvgmcnntlldgsidpsrkdlaeaernkl
spyrgfwsvtlggaeglyiddklgn

SCOPe Domain Coordinates for d2ooda2:

Click to download the PDB-style file with coordinates for d2ooda2.
(The format of our PDB-style files is described here.)

Timeline for d2ooda2: